PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000284922
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 652aa    MW: 71564.5 Da    PI: 6.3483
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000284922genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.7e-174287147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg+W++eEd  l ++v  +G ++W++Iar ++ gR++k+c++rw + 
    MDP0000284922 42 RGPWSPEEDAVLTRLVSNFGARNWSLIARGIP-GRSGKSCRLRWCNQ 87
                     89******************************.***********985 PP

2Myb_DNA-binding54.72.3e-1794138147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++++eEd ++v a++ +G++ W+ Ia+ ++ gRt++ +k++w++ 
    MDP0000284922  94 RKPFSEEEDRIIVSAHAIHGNK-WAVIAKLLP-GRTDNAIKNHWNST 138
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.3463788IPR017930Myb domain
SuperFamilySSF466892.08E-3039135IPR009057Homeodomain-like
SMARTSM007172.7E-144190IPR001005SANT/Myb domain
PfamPF002497.8E-164287IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-264395IPR009057Homeodomain-like
CDDcd001677.60E-134486No hitNo description
PROSITE profilePS5129425.67589143IPR017930Myb domain
SMARTSM007172.8E-1793141IPR001005SANT/Myb domain
PfamPF002492.2E-1594138IPR001005SANT/Myb domain
CDDcd001672.80E-1296139No hitNo description
Gene3DG3DSA:1.10.10.602.6E-2396142IPR009057Homeodomain-like
PROSITE profilePS5129219.018521587IPR011016Zinc finger, RING-CH-type
Gene3DG3DSA:3.30.40.108.9E-15525582IPR013083Zinc finger, RING/FYVE/PHD-type
SuperFamilySSF578502.47E-9526583No hitNo description
SMARTSM007441.3E-18528581IPR011016Zinc finger, RING-CH-type
PfamPF129062.6E-9529580IPR011016Zinc finger, RING-CH-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 652 aa     Download sequence    Send to blast
MTVPNDGVSK EADDVPGTEA ELIELGDAAE LNEGAGPSGK VRGPWSPEED AVLTRLVSNF  60
GARNWSLIAR GIPGRSGKSC RLRWCNQLDP CVKRKPFSEE EDRIIVSAHA IHGNKWAVIA  120
KLLPGRTDNA IKNHWNSTLK RRCFDKGRFY PGPGEMMEDD TFDRKKASSE ETLSVGNTSS  180
FKTREGQAKE GCCAAESKEH STLRAESRDH LTLQSTLCRP VARVSAFSVY NRPSDPANAS  240
AFSRTVPSHG PLVPTTKLDF GFLEGACNEP MVPEHCSHGC CDRVEGHSQS SLLGPEFVEY  300
DEPPPFSSHE LISIATDLNK IAWIKSSLES SAMSMPENVA SHRVVQVAAT TLQMGVPANN  360
PMNDHVRFEE GRNKLMGMMT EVLSTQSAER GLGERGRGYL PRQDPVAENL RNRLPTGLRA  420
SSTSVGVDDH GGPEPLHEES LSGFCKWQPQ TNPTWLLMWR RRKWDGAAPP RVEIATVTPA  480
PRGRRAREGR CSSESGSEIV ERESCVSESS VEVDLEEVKM HVAKVERDCR ICHLSMDATN  540
QESGIPIELG CSCKADLAAA HKQCAEAWFK IKGNKTCEIC GSTARNVSGL SEAELAEQWH  600
DEAALATTAG GAPVQTAESR NFWQGHRFLN FLLACMVFAF VISWLFHFNV PS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-38411426107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.7070.0fruit| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN3157830.0JN315783.1 Malus x domestica cultivar Golden Delicious R2R3-MYB transcription factor (MYB1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008392894.10.0PREDICTED: myb-related protein 306-like
TrEMBLA0FK200.0A0FK20_MALDO; MYB domain class transcription factor
STRINGVIT_13s0019g03200.t011e-137(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39863362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.11e-94myb domain protein 109